CVE-2026-15801

8 HIGH

Published 2026-09-21 · Updated 2026-09-21

AI risk analysis

Summary: The flaw allows a user with sufficient privileges to perform unintended operations on the host filesystem by exploiting container checkpoint and restore functionality.
Exploitability: Exploitation requires enabling container checkpoint and restore functionality and having access to untrusted checkpoint content, making it moderately difficult.
Blast radius: If exploited, this could lead to significant damage, including data corruption or theft on the host system.
Prioritized remediation: Disable container checkpoint and restore functionality unless absolutely necessary.

containerfilesystemprivilegecheckpoint

Analysis generated locally by qwen2.5:7b-instruct (no data left the box). AI-assisted — verify against primary sources before acting.

NVD description

A vulnerability was found in CRI-O related to the container checkpoint and restore feature. When CRI-O is configured to restore containers from checkpoint archives, insufficient validation of restore metadata may allow a user with sufficient privileges to perform unintended operations on the host filesystem. Successful exploitation requires that container checkpoint and restore functionality is enabled, which is not the default configuration. An attacker must also be able to trigger restoration of a container from untrusted checkpoint content.

CVSS vector

CVSS:3.1/AV:N/AC:H/PR:H/UI:N/S:C/C:H/I:H/A:H

Weaknesses

CWE-22

All references

Source data: NVD (nvd.nist.gov), public domain. Exploit-DB.ai adds local AI analysis for defensive use only.

Related CVEs

Related by shared AI tags and CWE weakness class. Browse the full archive.