← Back to search

CVE-2026-85526

9.9 CRITICALpublic exploit available

Published 2026-09-28 · Updated 2026-09-29

AI risk analysis

Summary
This flaw allows an authenticated user to traverse paths and delete or replace arbitrary files and directories on the host filesystem, posing a significant risk due to the elevated privileges involved.
Exploitability
Exploitation requires an authenticated user with instance creation privileges, making it moderately hard to exploit.
Blast radius
If exploited, this flaw could lead to complete host compromise, as the attacker can perform operations as root.
Detection
No reliable host or network indicator is derivable from the published description.
Prioritized remediation
Disable btrfs optimized backup import functionality or restrict access to the affected feature.
rceauth-bypassfilesystemprivilege-escalation

Analysis generated locally by qwen2.5:7b-instruct (no data left the box). AI-assisted — verify against primary sources before acting.

NVD description

Path traversal in the Btrfs storage driver (unpackVolume) in Canonical LXD on Linux allows an authenticated user with instance creation privileges to delete or replace arbitrary files and directories on the host filesystem as root via a crafted subvolumes[].path entry in backup/optimized_header.yaml during a btrfs optimized backup import.

CVSS vector

CVSS:3.1/AV:N/AC:L/PR:L/UI:N/S:C/C:H/I:H/A:H

Weaknesses

CWE-22

Public exploit & PoC references

All references

Source data: NVD (nvd.nist.gov), public domain. Exploit-DB.ai adds local AI analysis for defensive use only.

Related CVEs

Related by shared AI tags and CWE weakness class. Browse the full archive.